PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00881.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 272aa    MW: 31495.5 Da    PI: 7.5498
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00881.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd++l+++v+ +G g+W+  +++ g++R +k+c++rw++yl
       KHN00881.1 16 RGPWSAEEDQILINYVQVHGEGNWRELSKRAGLKRLGKSCRLRWLNYL 63
                     89******************************99************97 PP

2Myb_DNA-binding48.71.8e-1569114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++ +lG++ W++Ia +++ gRt+ ++k++w++yl
       KHN00881.1  69 RGNISSDEEDLIIRLHSLLGNR-WSLIAGRLP-GRTDHEIKNYWNTYL 114
                      78999*****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4841163IPR017930Myb domain
SMARTSM007176.5E-151565IPR001005SANT/Myb domain
SuperFamilySSF466891.5E-2915110IPR009057Homeodomain-like
PfamPF002492.2E-161663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-231770IPR009057Homeodomain-like
CDDcd001672.09E-111863No hitNo description
PROSITE profilePS5129425.29664118IPR017930Myb domain
SMARTSM007171.4E-1468116IPR001005SANT/Myb domain
PfamPF002494.9E-1469114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-2471118IPR009057Homeodomain-like
CDDcd001676.12E-1073114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MKRKGRSCDN QDAVNRGPWS AEEDQILINY VQVHGEGNWR ELSKRAGLKR LGKSCRLRWL  60
NYLKPDIKRG NISSDEEDLI IRLHSLLGNR WSLIAGRLPG RTDHEIKNYW NTYLRKKVEQ  120
NHNYNNLPGH NNIPIKLRIE SPRCSKNSLG IVIDPTKSSH PVTIKSMSCT EVMMPTRTVN  180
DFTTSWDKNP FASTPQDGHG HCSEGFLKHF DISDVLMPYE DCRFNEYACV EVPQHFGDEA  240
YKVIDAVGET RYDNWKIDDY FPLDYDVGFS LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0292703e-61AB029270.1 Glycine max mRNA for GmMYB13, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006606273.10.0PREDICTED: myb-related protein 305
TrEMBLA0A0B2NUS40.0A0A0B2NUS4_GLYSO; Transcription repressor MYB5
STRINGGLYMA20G32510.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15511512
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.13e-55myb domain protein 5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]